PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31413.1-v1.0-hybrid
Common NameMYB10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 236aa    MW: 27534.1 Da    PI: 9.0365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31413.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-141356548
                             -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             T+eEdell++ ++ +G g W+ ++ + g++R++k+c++rw++yl
  mrna31413.1-v1.0-hybrid 13 TKEEDELLKQFIEIHGEGKWHHVPLKSGLNRCRKSCRLRWLNYL 56
                             99****************************************97 PP

2Myb_DNA-binding47.93.1e-1562106147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg + ++E +l+++++k+lG++ W++Ia +++ gRt++++k++w++y
  mrna31413.1-v1.0-hybrid  62 RGEFAEDEVDLIIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTY 106
                              78999*****************.*********.************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.803156IPR017930Myb domain
SMARTSM007171.9E-11858IPR001005SANT/Myb domain
SuperFamilySSF466892.42E-258103IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-181363IPR009057Homeodomain-like
CDDcd001672.46E-91356No hitNo description
PfamPF002491.6E-121356IPR001005SANT/Myb domain
PROSITE profilePS5129424.23157111IPR017930Myb domain
SMARTSM007171.2E-1461109IPR001005SANT/Myb domain
PfamPF002494.3E-1462106IPR001005SANT/Myb domain
CDDcd001671.34E-964106No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2264110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEGYFGVRKG ASTKEEDELL KQFIEIHGEG KWHHVPLKSG LNRCRKSCRL RWLNYLKPNI  60
KRGEFAEDEV DLIIRLHKLL GNRWSLIAGR LPGRTANDVK NYWNTYQRKK DQKTASYAKQ  120
LKVKSQENTK ATTIVRPRPR TFIKRFNFTE RYENIEHNHS EMSYTSSLPT APPQTLQLEN  180
VTDWWKDFAE DSTESIDRTM CSGLIGLEDH DFFTNFWVED TVQSASNDLV NISYV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-2191104104MYB PROTO-ONCOGENE PROTEIN
1msf_C5e-2191104104C-Myb DNA-Binding Domain
1mse_C5e-2191104104C-Myb DNA-Binding Domain
1h8a_C6e-21911027127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1551630.0EU155163.1 Fragaria vesca R2R3 MYB transcription factor (MYB10) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302217.11e-178PREDICTED: transcription factor MYB114-like
SwissprotQ9FNV92e-60MY113_ARATH; Transcription factor MYB113
TrEMBLB5STZ91e-177B5STZ9_FRAVE; R2R3 MYB transcription factor
STRINGVIT_14s0006g01280.t012e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.19e-62myb domain protein 113
Publications ? help Back to Top
  1. Lin-Wang K, et al.
    An R2R3 MYB transcription factor associated with regulation of the anthocyanin biosynthetic pathway in Rosaceae.
    BMC Plant Biol., 2010. 10: p. 50
    [PMID:20302676]